PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000132627
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 409aa    MW: 46407.7 Da    PI: 6.5149
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000132627genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.89.3e-45912162128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                    ppG+rF+P d el+v+yL kkv +++l+  + i ev++y+++P+ L +k+++  ++wyfF++rd+ky++g+r++ra+ +gyWkatg dkev+s++g
  MDP0000132627  91 PPGYRFNPFDGELIVHYLMKKVLDQPLPP-NRIFEVNLYRYNPEVLAEKYEKYGDKWYFFTPRDRKYRNGSRPKRAAGDGYWKATGADKEVKSSDG 185
                    9*************************999.77**************988888889***************************************** PP

            NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                    ++vg +k Lvfy+g+ pkg kt+W+mhe+++
  MDP0000132627 186 AVVGSRKALVFYRGKPPKGDKTNWIMHEFKV 216
                    *****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-5288243IPR003441NAC domain
PROSITE profilePS5100552.65390243IPR003441NAC domain
PfamPF023652.8E-2391215IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MEPVEQSHPD HKASVTIITQ QVASYSLSPN KQSPAQGGQG QFTPTSETGV SLTTNVSAAA  60
GGTDHELSED EANSLHNNLI KDQDEFFNSF PPGYRFNPFD GELIVHYLMK KVLDQPLPPN  120
RIFEVNLYRY NPEVLAEKYE KYGDKWYFFT PRDRKYRNGS RPKRAAGDGY WKATGADKEV  180
KSSDGAVVGS RKALVFYRGK PPKGDKTNWI MHEFKVKDSP VRSRRGENDM RLDNWVLCRI  240
YKKDGQNGKR CESRNHAEIH SPFPHRINDE SMEIEMSGDI VDPLHEYDPA LEYDHKYSYK  300
AYPHMTPLPN ISGGLPVNMI SNNRIQSVEA ASMNAGSYYA NMGYSQPICV RPPSMSSESV  360
LGPYRYIDES TILQDDMMFG MKGFEHSLYS TNNYAGQFSA LDHVFPYTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-508924316165NAC domain-containing protein 19
4dul_A2e-508924316165NAC domain-containing protein 19
1ut7_B2e-508924316165NO APICAL MERISTEM PROTEIN
1ut7_A2e-508924316165NO APICAL MERISTEM PROTEIN
1ut4_B2e-508924316165NO APICAL MERISTEM PROTEIN
1ut4_A2e-508924316165NO APICAL MERISTEM PROTEIN
3swp_D2e-508924319168NAC domain-containing protein 19
3swp_C2e-508924319168NAC domain-containing protein 19
3swp_B2e-508924319168NAC domain-containing protein 19
3swp_A2e-508924319168NAC domain-containing protein 19
3swm_D2e-508924319168NAC domain-containing protein 19
3swm_C2e-508924319168NAC domain-containing protein 19
3swm_B2e-508924319168NAC domain-containing protein 19
3swm_A2e-508924319168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008363571.10.0PREDICTED: NAC domain-containing protein 68-like
RefseqXP_008363578.10.0PREDICTED: NAC domain-containing protein 68-like
TrEMBLM5X9E71e-147M5X9E7_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s05690.15e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-58NAC domain containing protein 32